PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01035477001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family M-type_MADS
Protein Properties Length: 184aa    MW: 21295.6 Da    PI: 10.5005
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01035477001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF48.79.9e-161253445
                       -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
             SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                       ++ + rq  +s+R++gil KA+ L vLCd++v++++fs+tgk
  GSVIVT01035477001 12 QSGRERQAKYSQRKQGILRKANDLAVLCDTDVLLLMFSPTGK 53
                       67789***********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004327.4E-20160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006620.997153IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.32E-19175IPR002100Transcription factor, MADS-box
CDDcd001204.28E-18254No hitNo description
PRINTSPR004044.5E-12323IPR002100Transcription factor, MADS-box
PfamPF003193.5E-141354IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-122338IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-123859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MGRRKLSIRR LQSGRERQAK YSQRKQGILR KANDLAVLCD TDVLLLMFSP TGKPCLTVGQ  60
NKNLLTVMER LASLSVDYRE ERAAYTLELL AKMHRRLNSD VDQKNFSLDS NEILQLKRSE  120
LEQLRSQLAE KSKAMRDWKF PSTVNDLGQI RRMENSLSEL MVRVRAKKRE FQEQEEVPES  180
SLP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4692305e-96AM469230.2 Vitis vinifera contig VV78X185365.4, whole genome shotgun sequence.
GenBankFQ3904525e-96FQ390452.1 Vitis vinifera clone SS0AEB17YK24.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010648389.11e-119PREDICTED: agamous-like MADS-box protein AGL11
TrEMBLF6H2S73e-93F6H2S7_VITVI; Putative uncharacterized protein
STRINGVIT_04s0008g01980.t018e-93(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP59461119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.23e-32AGAMOUS-like 30